Name:Recombinant Human Active regulator of SIRT1 protein (RPS19BP1)

Purity:>90% as determined by SDS-PAGE.

Gene name:RPS19BP1

Alternative Names: 
40S ribosomal protein S19 binding protein 1; 40S ribosomal protein S19-binding protein 1; Active regulator of SIRT1; AROS ; AROS_HUMAN; Homolog of mouse S19 binding protein; Ribosomal protein S19 binding protein 1; RPS19 binding protein 1 ; RPS19-binding protein 1; RPS19BP1; S19BP


Species:Homo sapiens (Human)

Protein length:Full Length

Source:E.coli

Molecular weight:42.4kDa

expression region:1-145aa

Amino acid sequence:

MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag:N-terminal GST-tagged

Specification:20ug/100ug/1mg