Name:Recombinant Human Lymphocyte antigen 6E (LY6E)

Purity:>90% as determined by SDS-PAGE.

Gene name:LY6E

Alternative Names: 
LY6E; 9804; RIGE; SCA2; TSA1; Lymphocyte antigen 6E; Ly-6E; Retinoic acid-induced gene E protein; RIG-E; Stem cell antigen 2; SCA-2; Thymic shared antigen 1; TSA-1


Species:Homo sapiens (Human)

Protein length:Full Length of Mature Protein

Source:E.coli

Molecular weight:24.5kDa

expression region:21-101aa

Amino acid sequence:
LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag: N-terminal 6xHis-SUMO-tagged

Specification:20ug/100ug/1mg