Technical advantages
								
								
								
								
							
									Recombinant Human Vascular endothelial growth factor C (VEGFC)								
								
								Name:Recombinant Human Vascular endothelial growth factor C (VEGFC)
Purity:>90% as determined by SDS-PAGE.
Gene name:VEGFC
	Alternative Names: 
	Flt 4L; Flt4 ligand; FLT4 ligand DHM; Flt4-L; Flt4L; Vascular endothelial growth factor C; Vascular endothelial growth factor related protein; Vascular endothelial growth factor-related protein; VEGF C; VEGF-C; Vegfc; VEGFC_HUMAN; VRP
	
Species:Homo sapiens (Human)
Protein length: Full Length of Mature Protein
Source:E.coli
Molecular weight:40.1kDa
	ex
	Amino acid sequence:
AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
	
	Amino acid sequence:N-terminal GST-tagged
Specification:20ug/100ug/1mg