Technical advantages
								
								
								
								
							
									Recombinant Human Thioredoxin (TXN)								
								
								Name:Recombinant Human Thioredoxin (TXN)
Purity:>90% as determined by SDS-PAGE.
Gene name:TXN
	Alternative Names: 
	ADF; ATL derived factor; ATL-derived factor; DKFZp686B1993; MGC61975; SASP; Surface associated sulphydryl protein; Surface-associated sulphydryl protein; testicular tissue protein Li 199; THIO_HUMAN; Thioredoxin; thioredoxin delta 3; TRDX; TRX 1; Trx; TRX1; TXN; TXN delta 3; TXN protein; zgc:92903
	
Species:Homo sapiens (Human)
Protein length:Full Length of Mature Protein
Source:E.coli
Molecular weight:38.6kDa
	ex
Amino acid sequence:
	VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
	
	Protein tag: N-terminal GST-tagged
Specification:20ug/100ug/1mg