Name:Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 (NDUFS5)

Purity:>90% as determined by SDS-PAGE.

Gene name:NDUFS5

Alternative Names: 
CI 15k; CI-15 kDa; CI15K; Complex I-15 kDa; NADH dehydrogenase (ubiquinone) Fe S protein 5, 15kDa (NADH coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 5; NADH-ubiquinone oxidoreductase 15 kDa subunit; NADH:ubiquinone oxidoreductase 15 kDa IP subunit; NDUFS5; NDUS5_HUMAN


Species:Homo sapiens (Human)

Protein length:Full Length of Mature Protein

Source:E.coli

Molecular weight:39.4kDa

expression region: 2-106aa

Amino acid sequence:

PFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag:N-terminal GST-tagged

Specification:20ug/100ug/1mg