Technical advantages
								
								
								
								
							
									Recombinant Human Cytochrome b-c1 complex subunit 10 protein (UQCR11)								
								
								Name:Recombinant Human Cytochrome b-c1 complex subunit 10 protein (UQCR11)
Purity:>90% as determined by SDS-PAGE.
Gene name:UQCR11
	Alternative Names: 
	UQCR11; UQCR; Cytochrome b-c1 complex subunit 10; Complex III subunit 10; Complex III subunit XI; Ubiquinol-cytochrome c reductase complex 6.4 kDa protein
	
Species:Homo sapiens (Human)
Protein length:Full Length
Source:E.coli
Molecular weight:33.6kDa
	ex
Amino acid sequence:
	MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
	
	Protein tag: N-terminal GST-tagged
Specification:20ug/100ug/1mg