Technical advantages
								
								
								
								
							
									Recombinant Human Gamma-aminobutyric acid receptor-associated protein (GABARAP), partial								
								
								Name:Recombinant Human Gamma-aminobutyric acid receptor-associated protein (GABARAP), partial
Purity:>90% as determined by SDS-PAGE.
Gene name:GABARAP
	Gene name:
	ATG8A; FLC 3B; FLC3B; FLJ25768; GABA type A receptor associated protein; GABA(A) receptor associated protein; GABA(A) receptor-associated protein; GABARAP a; GABARAP; Gamma aminobutyric acid receptor associated protein; Gamma-aminobutyric acid receptor-associated protein; GBRAP_HUMAN; MGC120154; MGC120155; MM 46; MM46
	
Species:Homo sapiens (Human)
Protein length:Partial
Source:E.coli
Molecular weight:40.8kDa
	ex
	Amino acid sequence:
KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
	
	Protein tag: N-terminal GST-tagged
Specification:20ug/100ug/1mg